NanoFuel® FLASH Assay for Oplophorus Luciferases
NanoFuel FLASH assay buffer is an alternative for assays that are using substrates like native Coelenterazine or Coeleterazine analogs to achieve even higher bioluminescent readouts with Oplophorus luciferases like NanoLuc® or NanoKAZ.
- Details & Info
- Protocols & Data
- Related Products
Kit content
- 50 ml NanoFuel® FLASH Reagent for Oplophorus Luciferase
- 1 ml 50X NLuc FLASH Substrate
Characteristics
-
one-step assay
-
bright luminescent signal for at least a few minutes
-
higher sensitivity than CTZ or Furimazine
-
low background, higher S/N ratio
-
enough reagent for 1000 assays
-
luminometer with injection port is recommended
-
although the substrate will diffuse into the cells this process can be accelerated by a lysis step, please select “add Lysis” under product options to add 50ml of 5x Universal Lysisbuffer (CAT# 333) to your order
Graph below: HEK293 cells were transformed with NLuc and assayed 2 days later using a luminometer with injection port. Compared to other NLuc assay buffers, Cat. #324 increased the inital lightoutput with a reduced signal half-life. This data was kindly provided by the Neuroscience Department at Central Michigan University.
Protocols & Manuals
Suitable for following luciferases
Oplophorus Luciferase (wildtype, 196 aa, 19.5 kDa) GI:10336559
MAYSTLFIIALTAVVTQASSTQKSNLTFTLADFVGDWQQTAGYNQDQVLEQGGLSSLFQALGVSVTPIQKVVLSGENGLKADIHVIIPYEGLSGFQMGLIEMIFKVVYPVDDHHFKIILHYGTLVIDGVTPNMIDYFGRPYPGIAVFDGKQITVTGTLWNGNKIYDERLINPDGSLLFRVTINGVTGWRLCENILA
NanoKAZ (171 aa, 19.1 kDa) GI:525342150
MVFTLEDFVGDWRQTAGYNLDQVLEQGGVSSLFQNLGVSVTPIQRIVLSGENGLKIDIHVIIPYEGLSGDQMGQIEKIFKVVYPVDDHHFKVILHYGTLVIDGVTPNMIDYFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLINPDGSLLFRVTINGVTGWRLCERILA
NanoLuc® (171 aa, 19.1 kDa) GI:386649645 NanoLuc® is a registered trademark of Promega Corp.
MVFTLEDFVGDWRQTAGYNLDQVLEQGGVSSLFQNLGVSVTPIQRIVLSGENGLKIDIHVIIPYEGLSGDQMGQIEKIFKVVYPVDDHHFKVILHYGTLVIDGVTPNMIDYFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLINPDGSLLFRVTINGVTGWRLCERILA
Certificates & Data
Suggestions
-
CAT# 325NLuc GLOW AssayFor a more steady, GLOW-type kineticread morel
- CAT# 3815NanoKAZ Luciferase Protein (PBS)NanoKAZ Luciferase in PBS, an Oplophorus Luciferase mutant is one of the smallest and brightest luciferases. This recom...read morel
- CAT# 381NanoKAZ Luciferase ProteinNanoKAZ Luciferase, an Oplophorus Luciferase mutant is one of the smallest and brightest luciferases. This recombinant ...read morel
By Category (NanoKaz (NLuc) Assay)
- 324NLuc FLASH Assay
- 325NLuc GLOW Assay
-
CAT# 325NLuc GLOW Assay