| Cat# | Name | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 321 | One of the smallest and brightest cloned luciferases. | One of the smallest and brightest cloned luciferases.
| |||||||||||
| 371 | Gaussia(M2)-Luciferase-Streptavidin is a conjugate of one of ... |
Gaussia(M2)-Luciferase-Streptavidin is a conjugate of one of the brightest luciferases and a protein with the highest known affinity in nature. This fusion protein can be used to detect trace amounts of biotinylated protein, DNA, or other biotinylated bio-molecules.
In experiments we were able to visualize the GLuc luminescence on the surface of Agarose-Biotin beads using a standard light microscope in total darkness. GLuc-SA was engineered by connecting one molecule of GLuc to one Streptavidin subunit. Streptavidin consists of 4 subunits with theoretically 4 biotin binding sites. Purified Streptavidin will have the ability to bind between 3.2 and 3.9 biotin molecules. Due to extensive purification steps, no free Streptavidin is present and cross-linking will be prevented, enabling quantitative read-outs in luminescent assays.
| |||||||||||
| 381 | NanoKAZ Luciferase, an Oplophorus Luciferase mutant is one o ... |
NanoKAZ Luciferase, an Oplophorus Luciferase mutant is one of the smallest and brightest luciferases. This recombinant protein was affinity purified to give it a maximum specific activity. Patent US 9,315,783 and US 9,404,145. |
| Compound ID | NanoKAZ Luciferase (NLuc) enzyme |
| MW | 19.2 kDa (theoretical) |
| Appearance | clear liquid as 1 mg/ml in TBS |
| Applications | as positive control in luminometer assays and general assay optimization |
| Production | recombinant expression in E.coli with subsequent affinity purification |
MVFTLEDFVGDWRQTAGYNLDQVLEQGGVSSLFQNLGVSVTPIQRIVLSGENGLKIDIHVIIPYEGLSGDQMGQIEKIFKVVYPVDDHHFKVILHYGTLVIDGVTPNMIDYFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLINPDGSLLFRVTINGVTGWRLCERILA


| Compound ID | NanoKAZ Luciferase (NLuc) enzyme (PBS) |
| MW | 19.2 kDa (theoretical) |
| Appearance | clear liquid as 1mg/ml in TBS |
| Applications | as positive control in luminometer assays and general assay optimization |
| Production | recombinant expression in E.coli with subsequent affinity purification |
MVFTLEDFVGDWRQTAGYNLDQVLEQGGVSSLFQNLGVSVTPIQRIVLSGENGLKIDIHVIIPYEGLSGDQMGQIEKIFKVVYPVDDHHFKVILHYGTLVIDGVTPNMIDYFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLINPDGSLLFRVTINGVTGWRLCERILA


MTSKVYDPELRKRMITGPQWWARCKQMNVLDSFINYYDSEKHAENAVIFLHGNAASSYLWRHVVPHVEPVARCIIPDLIGMGKSGKSGNGSYRLLDHYKYLTEWFKHLNLPKKIIFVGHDWGACLAFHYCYEHQDRIKAVVHAESVVDVIESWDEWPDIEEDIALIKSEEGEKMVLENNFFVETMLPSKIMRKLEPEEFAAYLEPFKEKGEVRRPTLSWPREIPLVKGGKPDVVEIVRNYNAYLRASHDLPKMFIESDPGFFSNAIVEGAKKFPNTEFVKVKGLHFSQEDAPDEMGNYIKSFVERVLKNEQ