![CAT-325c.product-thumb CAT-325c.product-thumb](https://nanolight.com/wp-content/uploads/2019/02/CAT-325c.product-thumb-300x300.jpg)
NanoFuel® GLOW Assay for Oplophorus Luciferases
Introducing a new GLOW Assay kit that will work with Oplophorus Luciferase and its variants NanoKAZ.
- Details & Info
- Protocols & Data
- Related Products
Kit content
- 50 ml NLuc GLOW buffer for Oplophorus Luciferases
- 1 ml 50x Substrate for Oplophorus Luciferases
Advantages
- one-step assay
- stable luminescent signal (half-life approx. 1.5 hrs)
- affordable
- high sensitivity
- low background, higher S/N ratio
- enough reagent for 1000 assays
- no injection port needed on the luminometer
For a more intense FLASH-type kinetic please see our NLuc FLASH Assay Cat. #324
Protocols & Manuals
Suitable for following luciferases
Oplophorus Luciferase (wildtype, 196 aa, 19.5 kDa) GI:10336559
MAYSTLFIIALTAVVTQASSTQKSNLTFTLADFVGDWQQTAGYNQDQVLEQGGLSSLFQALGVSVTPIQKVVLSGENGLKADIHVIIPYEGLSGFQMGLIEMIFKVVYPVDDHHFKIILHYGTLVIDGVTPNMIDYFGRPYPGIAVFDGKQITVTGTLWNGNKIYDERLINPDGSLLFRVTINGVTGWRLCENILA
NanoKAZ (171 aa, 19.1 kDa) GI:525342150
MVFTLEDFVGDWRQTAGYNLDQVLEQGGVSSLFQNLGVSVTPIQRIVLSGENGLKIDIHVIIPYEGLSGDQMGQIEKIFKVVYPVDDHHFKVILHYGTLVIDGVTPNMIDYFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLINPDGSLLFRVTINGVTGWRLCERILA
NanoLuc® (171 aa, 19.1 kDa) GI:386649645 NanoLuc® is a registered trademark of Promega Corp.
MVFTLEDFVGDWRQTAGYNLDQVLEQGGVSSLFQNLGVSVTPIQRIVLSGENGLKIDIHVIIPYEGLSGDQMGQIEKIFKVVYPVDDHHFKVILHYGTLVIDGVTPNMIDYFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLINPDGSLLFRVTINGVTGWRLCERILA
Suggestion
CAT# 3815NanoKAZ Luciferase Protein (PBS)NanoKAZ Luciferase in PBS, an Oplophorus Luciferase mutant is one of the smallest and brightest luciferases. This recom...read morel
CAT# 381NanoKAZ Luciferase ProteinNanoKAZ Luciferase, an Oplophorus Luciferase mutant is one of the smallest and brightest luciferases. This recombinant ...read morel
CAT# 324NLuc FLASH Assay
For a more intense FLASH-type kineticread morel
By Category (NanoKaz (NLuc) Assay)
- 324NLuc FLASH Assay
- 325NLuc GLOW Assay