Introducing a new one-step GLOW Assay kit for high-throughput screenings (HTS). This kit includes a buffer that will prolong your Gaussia signal over several hours. The half-life of Gaussia in this buffer system is between 2 to 3 hours.
- Details & Info
- Protocols & Data
- Publications
- Related Products
GLOW Assay Kit content
(sufficient for approx. 1000 assays)- 50 ml NanoFuel® GLOW Reagent for Gaussia Luciferase
- 1 ml 50x Coelenterazine Substrate for GLOW assay
Advantages
- one-step assay reagent (lysis-, dilution- and assay-buffer in one solution)
- stable luminescent signal (2-3 hours half-life)
- detection of secreted Gaussia Luciferase
- detection of intracellular expressed Gaussia Luciferase
- low background, thus high Signal to Noise ratio
Protocols & Manuals
For optimal results and a long lasting glow kinetic please use following Gaussia-M2 sequence (Welsh et al. , Multiply mutated Gaussia luciferases provide prolonged and intense bioluminescence, Biochemical and Biophysical Research Communications 389 (2009) 563–568):
GLuc-M2 (M43L, M110L)
KPTENNEDFNIVAVASNFATTDLDADRGKLPGKKLPLEVLKELEANARKAGCTRGCLICLSHIKCTPKMKKFIPGRCHTYEGDKESAQGGIGEAIVDIPEIPGFKDLEPLEQFIAQVDLCVDCTTGCLKGLANVQCSDLLKKWLPQRCATFASKIQGQVDKIKGAGGDGSLSTPPTPSPSTPPTGLNDIFEAQKIEWHE
Quick Instrucitons
Certificates & Data
GLuc GLOW SDS
Suggestion
CAT# 371Gaussia Luciferase-StreptavidinGaussia(M2)-Luciferase-Streptavidin is a conjugate of one of the brightest luciferases and a protein with the highest kn...read morel
CAT# 321Gaussia Luciferase ProteinOne of the smallest and brightest cloned luciferases.read morel
CAT# 319GLuc FLASH AssayNanoFuel® FLASH Assay for Gaussia Luciferase
The NanoFuel® FLASH Assay kit provides enough buffer for approx. 1000 ...read morel
By Category (Gaussia Luc (GLuc) Assay)
- 319GLuc FLASH Assay
- 320GLuc GLOW Assay