NanoKAZ Luciferase, an Oplophorus Luciferase mutant is one of the smallest and brightest luciferases. This recombinant protein was affinity purified to give it a maximum specific activity. Patent US 9,315,783 and US 9,404,145.
- Details & Info
- Protocols & Data
- Related Products
Compound ID NanoKAZ Luciferase (NLuc) enzyme MW 19.2 kDa (theoretical) Appearance clear liquid as 1 mg/ml in TBS Applications as positive control in luminometer assays and general assay optimization Production recombinant expression in E.coli with subsequent affinity purification Sequence
MVFTLEDFVGDWRQTAGYNLDQVLEQGGVSSLFQNLGVSVTPIQRIVLSGENGLKIDIHVIIPYEGLSGDQMGQIEKIFKVVYPVDDHHFKVILHYGTLVIDGVTPNMIDYFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLINPDGSLLFRVTINGVTGWRLCERILA
SDS-PAGE
Activity
Certificates & Data
#381 NLuc Lot#A1020 COA
Recommended Assay Buffers
CAT# 325NLuc GLOW AssayNanoFuel® GLOW Assay for Oplophorus Luciferases
Introducing a new GLOW Assay kit that will work with Oplophorus Luc...read morel
CAT# 3815NanoKAZ Luciferase Protein (PBS)NanoKAZ Luciferase in PBS, an Oplophorus Luciferase mutant is one of the smallest and brightest luciferases. This recom...read morel
CAT# 324NLuc FLASH AssayNanoFuel® FLASH Assay for Oplophorus Luciferases
NanoFuel FLASH assay buffer is an alternative for assays that are usi...read morel
By Category (Luciferase Proteins)
- 321Gaussia Luciferase Protein
- 371Gaussia Luciferase-Streptavidin
- 381NanoKAZ Luciferase Protein
- 3815NanoKAZ Luciferase Protein (PBS)
- 312Renilla Mulleri Luciferase