Aequorin photoprotein (liquid)

Aequorin photoprotein (untagged) is recombinantly produced in E. coli, purified via multi-step chromatography and appears as a yellow liquid.

Concentration

2 mg/ml in 1.2M (NH4)2SO4, 250 μl per tube Sequence MTSKQYSVKLTSDFDNPRWIGRHKHMFNFLDVNHNGKISLDEMVYKASDIVINN LGATPEQAKRHKDAVEAFFGGAGMKYGVETDWPAYIEGWKKLATDELEKYAKNE PTLIRIWGDALFDIVDKDQNGAITLDEWKAYTKAAGIIQSSEDCEETFRVCDIDESG QLDVDEMTRQHLGFWYTMDPACEKLYGGAVP

Applications

positive control in Ca2+ assays

Purity > 95% by SDS-PAGE

#307-L gel picture by Bruce

Coelenterazine native

Package Contents: 500 ugs  – 1 vial of 500 µgs lyophilized CTZ 1 mgs – 2 vials of 500 µgs lyophilized CTZ 5 mgs – 1 vial of 5 mgs lyophilized CTZ 10 mgs – 2 vials of 5 mgs lyophilized CTZ

The advantages of lyophilized luciferins are:

  • pre-aliquoted in small amounts, fresh substrate for every set of experiments
  • long shelf-life (packaged under Argon)
  • faster to dissolve due to its fine crystal structure
  • consistent quality between aliquots
This luciferin is shipped as filtered, lyophilized, batch controlled substrate. Available in different sizes. Please inquire for custom aliquots.    

Coelenterazine-INJ

medical-imaging Coelenterazine (native-CTZ) in sterile injection vials with a low retention volume. Each kit is supplied with two ‘Inject-A-Lume’ vials of 500 µg CTZ and 500 µl of sterile ‘Fuel-Inject’ diluent. ‘Fuel-Inject’ will improve the luciferase signal compared to conventional Ethanol-dissolved CTZ. Recommended path of injection: intra-peritoneal cavity. For more frequent injections we recommend our water-soluble Coelenterazine. For animal use only.

Coelenterazine-SOL (in vitro)

Application Example

CTZ-SOLinvitro

Advantages of water-soluble Coelenterazine

  • convenient to use, no pre-dissolving of h CTZ in alcohol necessary
  • can be used with different buffers for assay optimization 

Coelenterazine-SOL (in vivo)

Package Contents: 500 ugs  – 1 vial of 500 ugs lyophilized SOL-CTZ 1 mgs – 2 vials of 500 ugs lyophilized SOL-CTZ 10 mgs – 20 vials of 500 ugs lyophilized SOL-CTZ  
Coelenterazine is often dissolved in Propyleneglycol (PG) in combination with other alcohols for in vivo imaging studies. Large intravenous doses of PG given over a short period of time can be toxic, including  hyperosmolality, increased anion gap metabolic acidosis (due to lactic acidosis), acute kidney injury, and sepsis-like syndrome.
This can be avoided using water-soluble Coelenterazine. It is formulated to be isosmotic and easily secreted by the kidneys. Thus save for repeated i.v. injections. Water soluble Coelenterazine can be injected up to a 500 µg/100 µl concentration, achieving very high Coelenterazine levels within the body and leading to high Gaussia luciferase signals.

Application Example

picture for S-CTZ webpage

Controls

We offer the solubilization vehicle without the Coelenterazine as injection control. Any side effects due to the injection process can be easily monitored, especially in sensitive applications like bioluminescent driven Optogenetics. One vial of the control (Cat. #3031-10+C) contains the same amount of solubilizer as one vial of Cat.#3031. The control will be dissolved in sterile water to create an iso-osmotic solution ready to inject. To order control: please select ’10 mgs + 10 vials control’ under product options. This includes 20 vials of 500ug water-soluble CTZ and 10 vials of control. Please inquire if larger quantities of Cat.#3031-10+C are needed.  

e-Coelenterazine-SOL (in vivo)

Package Contents: 500 ugs  – 1 vial of 500 ugs lyophilized e-CTZ-SOL 1 mgs – 2 vials of 500 ugs lyophilized e-CTZ-SOL 10 mgs – 20 vials of 500 ugs lyophilized e-CTZ-SOL  
e-Coelenterazine is often dissolved in Propyleneglycol (PG) in combination with other alcohols for in vivo imaging studies. Large intravenous doses of PG given over a short period of time can be toxic, including  hyperosmolality, increased anion gap metabolic acidosis (due to lactic acidosis), acute kidney injury, and sepsis-like syndrome.
This can be avoided using water-soluble e-Coelenterazine. It is formulated to be isosmotic and easily secreted by the kidneys. Thus save for repeated i.v. injections. Water soluble e-Coelenterazine can be injected up to a 500 µg/100 µl concentration, achieving very high e-Coelenterazine levels within the body and leading to high Renilla luciferase signals.

Application Example

picture for S-CTZ webpage

Controls

We offer the solubilization vehicle without the e-Coelenterazine as injection control. Any side effects due to the injection process can be easily monitored. One vial of the control (Cat. #3551-10+C) contains the same amount of solubilizer as one vial of Cat.#3551. The control will be dissolved in sterile water to create an iso-osmotic solution ready to inject. To order control: please select ’10 mgs + 10 vials control’ under product options. This includes 20 vials of 500ug water-soluble CTZ and 10 vials of control. Please inquire if larger quantities of Cat.#3551-10+C are needed.  

Gaussia Luciferase Protein

321_E1016_gel
 

GLuc GLOW Assay

Advantages

  • one-step assay reagent (lysis-, dilution- and assay-buffer in one solution)
  • stable luminescent signal (2-3 hours half-life)
  • detection of secreted Gaussia Luciferase
  • detection of intracellular expressed Gaussia Luciferase
  • low background, thus high Signal to Noise ratio
320-kinetic

NLuc FLASH Assay

Kit content

  • 50 ml NanoFuel® FLASH Reagent for Oplophorus Luciferase
  • 1 ml 50X NLuc FLASH Substrate

Characteristics

  • one-step assay
  • bright luminescent signal for at least a few minutes
  • higher sensitivity than CTZ or Furimazine
  • low background, higher S/N ratio
  • enough reagent for 1000 assays
  • luminometer with injection port is recommended
  • although the substrate will diffuse into the cells this process can be accelerated by a lysis step, please select “add Lysis” under product options to add 50ml of 5x Universal Lysisbuffer (CAT# 333) to your order

Graph below: HEK293 cells were transformed with NLuc and assayed 2 days later using a luminometer with injection port. Compared to other NLuc assay buffers, Cat. #324 increased the inital lightoutput with a reduced signal half-life. This data was kindly provided by the Neuroscience Department at Central Michigan University.

324_comparison_graph

Polyclonal Antisera Gluc

Polyclonal Antisera Pt. GFP

Ptilosarcus Green Fluorescent protein

pUC18 Gluc

Map

Sequence

200 pUC18 Gluc map
200 pUC18 Gluc sequencepdf-icon 200 pUC18 Gluc sequenceview-icon download-icon

Application

Gaussia luciferase is used as a reporter in conjunction with CRISPR to investigate the function of noncoding RNAs (ncRNA) : Multiplexable, locus-specific targeting of long RNAs with CRISPR-DisplayShechner DM, Hacisuleyman E, Younger ST, Rinn JL. July 2015. PubMed

pUC19 R.M. GFP

Map

Sequence

101 pUC19 RM GFP map
101 pUC19-RM-GFP sequence & mappdf-icon 101 pUC19-RM-GFP sequence & mapview-icon download-icon

Aequorin photoprotein (lyophilized)

Aequorin photoprotein (untagged) is recombinantly produced in E. coli, purified via multi-step chromatography and appears as a white lyophilized powder.

Reconstitution

with Ca2+ free double distilled water

Sequence

MTSKQYSVKLTSDFDNPRWIGRHKHMFNFLDVNHNGKISLDEMVYKASDIVINN LGATPEQAKRHKDAVEAFFGGAGMKYGVETDWPAYIEGWKKLATDELEKYAKNE PTLIRIWGDALFDIVDKDQNGAITLDEWKAYTKAAGIIQSSEDCEETFRVCDIDESG QLDVDEMTRQHLGFWYTMDPACEKLYGGAVP Application postitive control in Ca2+ assays

Purity > 95% by SDS-PAGE

AEQ-QC Lot C0314 gel

Coelenterazine h

Package Contents: 500 ugs  – 1 vial of 500 ugs lyophilized CTZ-h 1 mgs – 2 vials of 500 ugs lyophilized CTZ-h 5 mgs – 1 vial of 5 mgs lyophilized CTZ-h 10 mgs – 2 vials of 5 mgs lyophilized CTZ-h  

The advantages of lyophilized luciferins are:

  • Pre-aliquoted in small amounts, fresh substrate for every set of experiments
  • long shelf-life (packed under Argon)
  • faster to dissolve due to its fine crystal structure
  • consistent quality between aliquotes
The luciferin is shipped as filtered, lyophilized, batch controlled substrate