Gaussia Luciferase-Streptavidin

In experiments we were able to visualize the GLuc luminescence on the surface of Agarose-Biotin beads using a standard light microscope in total darkness. GLuc-SA was engineered by connecting one molecule of GLuc to one Streptavidin subunit. Streptavidin consists of 4 subunits with theoretically 4 biotin binding sites. Purified Streptavidin will have the ability to bind between 3.2 and 3.9 biotin molecules. Due to extensive purification steps, no free Streptavidin is present and cross-linking will be prevented, enabling quantitative read-outs in luminescent assays.

GLuc-SA_agarose_bead

  • bioluminescent detection of biotinylated biomolecules (protein, DNA, peptides) in ELISA-style assays
  • wide dynamic range
  • low background (no interfering BSA/FCS is used in this reagent)
  • highly sensitive
  • strong biotin binding
  • bioluminescent surface labeling generating high signal/noise ratios
  • overcoming problems like autofluorescence
  • recommended equipment (Olympus LV-200)

GLuc FLASH Assay

Advantages of the FLASH Assay Reagent for Gaussia Luciferase:

  • creates optimal conditions for GLuc and mutated GLuc versions
  • low background, thus higher S/N ratio
  • higher overall signal
  • buffer has protein stabilizing properties
319-comparison

h-Coelenterazine-INJ

Benzyl Coelenterazine (h-CTZ) in sterile injection vials with a low retention volume. Each kit is supplied with two ‘Inject-A-Lume’ vials of 500 µg h-CTZ and a sterile ‘Fuel-Inject’ diluent. For animal use only.

h-Coelenterazine-SOL (in vitro)

Advantages of water-soluble Coelenterazine

  • convient to use, no pre-dissolving of h CTZ in alcohol necessary
  • can be used with different buffers for assay optimization 

h-Coelenterazine-SOL (in vivo)

Package Contents: 500 ugs  – 1 vial of 500 ugs lyophilized SOL-CTZ-h 1 mgs – 2 vials of 500 ugs lyophilized SOL-CTZ-h 10 mgs – 20 vials of 500 ugs lyophilized SOL-CTZ-h
Coelenterazine compounds are often dissolved in Propyleneglycol (PG) in combination with other alcohols for in vivo imaging studies. Large intravenous doses of PG given over a short period of time can be toxic, including  hyperosmolality, increased anion gap metabolic acidosis (due to lactic acidosis), acute kidney injury, and sepsis-like syndrome.
This can be avoided using water-soluble h-Coelenterazine. It is formulated to be isosmotic and easily secreted by the kidneys. Thus save for repeated i.v. injections. Water-soluble h-Coelenterazine can be injected up to a 500 µg/100 µl concentration, achieving very high Coelenterazine levels within the body and leading to high luciferase signals.
 
h-Coelenterazine is one of the preferred substrates for Renilla Luciferase.
If you use Gaussia Luciferase in your assay please use Cat. #3031

Advantages of water-soluble Coelenterazine

  • non-toxic, iso-osmotic, Propylene-Glycol free, Alcohol free
  • long shelf-life, sealed under vacuum
  • dissolves fast in sterile water
  • low viscosity – ideal for injections
  • consistent quality due to small aliquot sizes

Controls

We offer the solubilization vehicle without the h-Coelenterazine as injection control. Any side effects due to the injection process can be easily monitored, especially in sensitive applications like bioluminescent driven Optogenetics. One vial of the control (Cat. #3011-10+C) contains the same amount of solubilizer as one vial of Cat.#3011. The control will be dissolved in sterile water to create an iso-osmotic solution ready to inject. To order control: please select ’10 mgs + 10 vials control’ under available sizes. This includes 20 vials of 500 µg water-soluble h-CTZ  and 10 vials of control. Please inquire if larger quantities of Cat.#3011-10+C are needed.

Monoclonal Anti-Gluc

NLuc GLOW Assay

Kit content

  • 50 ml NLuc GLOW buffer for Oplophorus Luciferases
  • 1 ml 50x Substrate for Oplophorus Luciferases

Advantages

  • one-step assay
  • stable luminescent signal (half-life approx. 1.5 hrs)
  • affordable
  • high sensitivity
  • low background, higher S/N ratio
  • enough reagent for 1000 assays
  • no injection port needed on the luminometer
 
Oplo-kinetic
  For a more intense FLASH-type kinetic please see our NLuc FLASH Assay Cat. #324

Polyclonal Antisera RR GFP

pUC18 Pt. GFP

Sequence

102 pUC18-Pt-GFP sequencepdf-icon 102 pUC18-Pt-GFP sequenceview-icon

pUC18 SS-Gluc

Map

Sequence

201 pUC18 SS- Gluc map
201 pUC18 SS- Gluc sequencepdf-icon 201 pUC18 SS- Gluc sequenceview-icon

Application

Gaussia luciferase is used as a reporter in conjunction with CRISPR to investigate the function of noncoding RNAs (ncRNA) : Multiplexable, locus-specific targeting of long RNAs with CRISPR-DisplayShechner DM, Hacisuleyman E, Younger ST, Rinn JL. July 2015. PubMed

 

Renilla Reniformis GFP

Renilla Reniformis GFP is a highly purified green fluorescent protein isolated from the sea pansy Renilla reniformis, giving researchers a brighter, high-purity alternative to standard fluorescent tags. With excitation and emission maxima at 495 nm and 508 nm respectively, it delivers roughly three times the brightness of eGFP or Aequorea GFP, making it a strong choice for applications where signal strength is critical. Each lot is verified as a single band on SDS-PAGE, consistent with the purity standard behind every NanoLight fluorescent protein. Supplied purified and ready for use, it should be stored dark at -20°C (or -80°C for extended shelf life) and ships at room temperature via overnight or 2-day domestic courier. Available in 1 mg and 10 mg sizes, with a Certificate of Analysis available for download.

Coelenterazine 400a

Package Contents: 500 ugs  – 1 vial of 500 ugs lyophilized CTZ 400a 1 mgs – 2 vials of 500 ugs lyophilized CTZ 400a 5 mgs – 1 vial of 5 mgs lyophilized CTZ 400a 10 mgs – 2 vials of 5 mgs lyophilized CTZ 400a  

Advantages

  • pre-aliquoted in small amounts, fresh substrate for every set of experiments
  • long shelf-life (packed under Argon)
  • faster to dissolve due to its fine crystal structure
  • consistent quality between aliquotes
The luciferin is shipped as filtered, lyophilized, batch controlled substrate

e-Coelenterazine-INJ

e-coelenterazine or Coelenterazine-E (e-CTZ) is a synthetic analogue of native Coelenterazine with an additional ethyl group, forming an additional ring system. First described by Shimomura in 1989.   For Renilla muelleri Luciferase, an increase of 750% in initial intensity and 137% in total light was observed using e-Coelenterazine compared to naitve Coelenterazine.    Note: In will not be utilized by Gaussia Luciferase. 

NanoKAZ Luciferase (NLuc) Protein

Sequence

MVFTLEDFVGDWRQTAGYNLDQVLEQGGVSSLFQNLGVSVTPIQRIVLSGENGLKIDIHVIIPYEGLSGDQMGQIEKIFKVVYPVDDHHFKVILHYGTLVIDGVTPNMIDYFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLINPDGSLLFRVTINGVTGWRLCERILA

SDS-PAGE

381 SDS PAGE

Activity

381 A1020 activity  

NanoKAZ Luciferase Protein (PBS)

Sequence

MVFTLEDFVGDWRQTAGYNLDQVLEQGGVSSLFQNLGVSVTPIQRIVLSGENGLKIDIHVIIPYEGLSGDQMGQIEKIFKVVYPVDDHHFKVILHYGTLVIDGVTPNMIDYFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLINPDGSLLFRVTINGVTGWRLCERILA

SDS-PAGE

381

Activity

3815 activity  

pCMV-Gluc

Map

Sequence

202 pCMV-Gluc - map
202 pCMV-GLUC-1_pdfpdf-icon 202 pCMV-GLUC-1_pdfview-icon

Application

Gaussia luciferase is used as a reporter in conjunction with CRISPR to investigate the function of noncoding RNAs (ncRNA) : Multiplexable, locus-specific targeting of long RNAs with CRISPR-DisplayShechner DM, Hacisuleyman E, Younger ST, Rinn JL. July 2015. PubMed